SCOC (NM_032547) Human Mass Spec Standard
CAT#: PH309356
SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936)
View other "SCOC" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209356 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC209356 protein sequence
Red=Cloning site Green=Tags(s) MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQ HTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115936 |
RefSeq Size | 1974 |
RefSeq ORF | 363 |
Synonyms | HRIHFB2072; SCOCO; UNC-69 |
Locus ID | 60592 |
Cytogenetics | 4q31.1 |
Summary | This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410036 | SCOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431758 | SCOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410036 | Transient overexpression lysate of short coiled-coil protein (SCOC), transcript variant 4 |
CNY 3,080.00 |
|
LY431758 | Transient overexpression lysate of short coiled-coil protein (SCOC), transcript variant 6 |
CNY 3,080.00 |
|
TP309356 | Recombinant protein of human short coiled-coil protein (SCOC), 20 µg |
CNY 2,900.00 |
|
TP328730 | Recombinant protein of human short coiled-coil protein (SCOC), transcript variant 6, 20 µg |
CNY 2,900.00 |