RAB43 (NM_198490) Human Mass Spec Standard
CAT#: PH309159
RAB43 MS Standard C13 and N15-labeled recombinant protein (NP_940892)
View other "RAB43" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB43 MS Standard C13 and N15-labeled recombinant protein (NP_940892) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209159 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC209159 protein sequence
Red=Cloning site Green=Tags(s) MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQ IWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELRE VSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC GC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_940892 |
RefSeq Size | 4498 |
RefSeq ORF | 636 |
Synonyms | RAB11B; RAB41 |
Locus ID | 339122 |
Cytogenetics | 3q21.3 |
Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The low intrinsic GTPase activity of RAB43 is activated by USP6NL. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for the structural integrity of the Golgi complex. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404923 | RAB43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404923 | Transient overexpression lysate of RAB43, member RAS oncogene family (RAB43) |
CNY 3,080.00 |
|
TP309159 | Recombinant protein of human RAB43, member RAS oncogene family (RAB43), 20 µg |
CNY 2,900.00 |