CCDC25 (NM_018246) Human Mass Spec Standard
CAT#: PH309050
CCDC25 MS Standard C13 and N15-labeled recombinant protein (NP_060716)
View other "CCDC25" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CCDC25 MS Standard C13 and N15-labeled recombinant protein (NP_060716) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209050 |
Predicted MW | 24.3 kDa |
Protein Sequence |
>RC209050 representing NM_018246
Red=Cloning site Green=Tags(s) MVFYFTSSSVNSSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIEDIPKEVLMD CAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVER FPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060716 |
RefSeq Size | 3653 |
RefSeq ORF | 624 |
Locus ID | 55246 |
Cytogenetics | 8p21.1 |
Summary | Transmembrane receptor that senses neutrophil extracellular traps (NETs) and triggers the ILK-PARVB pathway to enhance cell motility (PubMed:32528174). NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation (PubMed:32528174). Formation of NETs is also associated with cancer metastasis, NET-DNA acting as a chemotactic factor to attract cancer cells (PubMed:32528174). Specifically binds NETs on its extracellular region, in particular the 8-OHdG-enriched DNA present in NETs, and recruits ILK, initiating the ILK-PARVB cascade to induce cytoskeleton rearrangement and directional migration of cells (PubMed:32528174). In the context of cancer, promotes cancer metastasis by sensing NETs and promoting migration of tumor cells (PubMed:32528174).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413187 | CCDC25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413187 | Transient overexpression lysate of coiled-coil domain containing 25 (CCDC25) |
CNY 3,080.00 |
|
TP309050 | Recombinant protein of human coiled-coil domain containing 25 (CCDC25), 20 µg |
CNY 2,900.00 |