HBQ1 (NM_005331) Human Mass Spec Standard
CAT#: PH308857
HBQ1 MS Standard C13 and N15-labeled recombinant protein (NP_005322)
View other "HBQ1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HBQ1 MS Standard C13 and N15-labeled recombinant protein (NP_005322) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208857 |
Predicted MW | 15.5 kDa |
Protein Sequence |
>RC208857 protein sequence
Red=Cloning site Green=Tags(s) MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLA VERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSE YR TRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005322 |
RefSeq Size | 653 |
RefSeq ORF | 426 |
Synonyms | HBQ |
Locus ID | 3049 |
Cytogenetics | 16p13.3 |
Summary | Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-globin gene cluster that involves five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-2 -pseudoalpha-1 - alpha-2 - alpha-1 - theta-1 - 3'. Research supports a transcriptionally active role for the gene and a functional role for the peptide in specific cells, possibly those of early erythroid tissue. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417378 | HBQ1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417378 | Transient overexpression lysate of hemoglobin, theta 1 (HBQ1) |
CNY 3,080.00 |
|
TP308857 | Recombinant protein of human hemoglobin, theta 1 (HBQ1), 20 µg |
CNY 2,900.00 |