CGGBP1 (NM_003663) Human Mass Spec Standard
CAT#: PH308653
CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003654)
View other "CGGBP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003654) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208653 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC208653 protein sequence
Red=Cloning site Green=Tags(s) MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI PKSDQLRRAYLPDGYENENQLLNSQDC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003654 |
RefSeq Size | 4506 |
RefSeq ORF | 501 |
Synonyms | CGGBP; p20-CGGBP |
Locus ID | 8545 |
Cytogenetics | 3p11.1 |
Summary | This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences. [provided by RefSeq, Jul 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418512 | CGGBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423417 | CGGBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418512 | Transient overexpression lysate of CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2 |
CNY 3,080.00 |
|
LY423417 | Transient overexpression lysate of CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1 |
CNY 3,080.00 |
|
PH323883 | CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001008391) |
CNY 19,520.00 |
|
TP308653 | Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP323883 | Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1, 20 µg |
CNY 2,900.00 |