FBXO3 (NM_012175) Human Mass Spec Standard
CAT#: PH308494
FBXO3 MS Standard C13 and N15-labeled recombinant protein (NP_036307)
View other "FBXO3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FBXO3 MS Standard C13 and N15-labeled recombinant protein (NP_036307) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208494 |
Predicted MW | 54.6 kDa |
Protein Sequence |
>RC208494 protein sequence
Red=Cloning site Green=Tags(s) MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQ KNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPD DYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAV EAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVAT TGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVG EFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036307 |
RefSeq Size | 2408 |
RefSeq ORF | 1413 |
Synonyms | FBA; FBX3 |
Locus ID | 26273 |
Cytogenetics | 11p13 |
Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409557 | FBXO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415952 | FBXO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409557 | Transient overexpression lysate of F-box protein 3 (FBXO3), transcript variant 2 |
CNY 3,080.00 |
|
LY415952 | Transient overexpression lysate of F-box protein 3 (FBXO3), transcript variant 1 |
CNY 3,080.00 |
|
TP308494 | Recombinant protein of human F-box protein 3 (FBXO3), transcript variant 1, 20 µg |
CNY 2,900.00 |