CST6 (NM_001323) Human Mass Spec Standard
CAT#: PH307689
CST6 MS Standard C13 and N15-labeled recombinant protein (NP_001314)
View other "CST6" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CST6 MS Standard C13 and N15-labeled recombinant protein (NP_001314) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207689 |
Predicted MW | 16.5 kDa |
Protein Sequence |
>RC207689 protein sequence
Red=Cloning site Green=Tags(s) MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFR DTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQ LLKHNCVQM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001314 |
RefSeq Size | 618 |
RefSeq ORF | 447 |
Synonyms | ECTD15 |
Locus ID | 1474 |
Cytogenetics | 11q13.1 |
Summary | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400530 | CST6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400530 | Transient overexpression lysate of cystatin E/M (CST6) |
CNY 3,080.00 |
|
TP307689 | Recombinant protein of human cystatin E/M (CST6), 20 µg |
CNY 2,900.00 |
|
TP720291 | Recombinant protein of human cystatin E/M (CST6) |
CNY 3,140.00 |