Spasmolytic Polypeptide (TFF2) (NM_005423) Human Mass Spec Standard
CAT#: PH307571
TFF2 MS Standard C13 and N15-labeled recombinant protein (NP_005414)
View other "Spasmolytic Polypeptide" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TFF2 MS Standard C13 and N15-labeled recombinant protein (NP_005414) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207571 |
Predicted MW | 14.3 kDa |
Protein Sequence |
>RC207571 protein sequence
Red=Cloning site Green=Tags(s) MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF HPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005414 |
RefSeq Size | 717 |
RefSeq ORF | 387 |
Synonyms | SML1; SP |
Locus ID | 7032 |
Cytogenetics | 21q22.3 |
Summary | Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417317 | TFF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417317 | Transient overexpression lysate of trefoil factor 2 (TFF2) |
CNY 3,080.00 |
|
TP307571 | Recombinant protein of human trefoil factor 2 (TFF2), 20 µg |
CNY 2,900.00 |
|
TP720721 | Purified recombinant protein of Human trefoil factor 2 (TFF2) |
CNY 3,140.00 |
其它Spasmolytic Polypeptide产品