Enkephalin (PENK) (NM_006211) Human Mass Spec Standard
CAT#: PH307563
PENK MS Standard C13 and N15-labeled recombinant protein (NP_006202)
View other "Enkephalin" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PENK MS Standard C13 and N15-labeled recombinant protein (NP_006202) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207563 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC207563 protein sequence
Red=Cloning site Green=Tags(s) MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQ LSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006202 |
RefSeq Size | 1221 |
RefSeq ORF | 801 |
Synonyms | enkephalin A; preproenkephalin; proenkephalin |
Locus ID | 5179 |
Cytogenetics | 8q12.1 |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. [provided by RefSeq, Jul 2015] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401880 | PENK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427669 | PENK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401880 | Transient overexpression lysate of proenkephalin (PENK), transcript variant 2 |
CNY 3,080.00 |
|
LY427669 | Transient overexpression lysate of proenkephalin (PENK), transcript variant 1 |
CNY 3,080.00 |
|
PH327805 | PENK MS Standard C13 and N15-labeled recombinant protein (NP_001129162) |
CNY 19,520.00 |
|
TP307563 | Recombinant protein of human proenkephalin (PENK), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327805 | Recombinant protein of human proenkephalin (PENK), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Enkephalin产品