United States
Germany
Japan
United Kingdom
China
MARCHF2 (NM_016496) Human Mass Spec Standard
CAT＃: PH307517
MARCH2 MS Standard C13 and N15-labeled recombinant protein (NP_057580)
View other "MARCHF2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | MARCH2 MS Standard C13 and N15-labeled recombinant protein (NP_057580) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207517 |
| Predicted MW | 27 kDa |
| Protein Sequence |
>RC207517 protein sequence
Red=Cloning site Green=Tags(s) MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRTLDTPSDGPFCRICHEG ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057580 |
| RefSeq Size | 1705 |
| RefSeq ORF | 738 |
| Synonyms | HSPC240; MARCH-II; MARCH2; RNF172 |
| Locus ID | 51257 |
| Cytogenetics | 19p13.2 |
| Summary | MARCH2 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH2 reduces surface accumulation of several glycoproteins and appears to regulate early endosome-to-trans-Golgi network (TGN) trafficking (Bartee et al., 2004 [PubMed 14722266]; Nakamura et al., 2005 [PubMed 15689499]).[supplied by OMIM, Mar 2010] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413937 | 42065 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423720 | 42065 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423721 | 42065 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413937 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1 |
CNY 3,080.00 |
|
| LY423720 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 2 |
CNY 3,080.00 |
|
| LY423721 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 3 |
CNY 3,080.00 |
|
| PH318593 | MARCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001005415) |
CNY 19,520.00 |
|
| TP307517 | Recombinant protein of human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP318593 | Recombinant protein of human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它MARCHF2产品
