C20orf77 (RPRD1B) (NM_021215) Human Mass Spec Standard
CAT#: PH307481
RPRD1B MS Standard C13 and N15-labeled recombinant protein (NP_067038)
View other "C20orf77" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RPRD1B MS Standard C13 and N15-labeled recombinant protein (NP_067038) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207481 |
Predicted MW | 36.9 kDa |
Protein Sequence |
>RC207481 protein sequence
Red=Cloning site Green=Tags(s) MSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNS KRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAT EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQD VSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYK QKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_067038 |
RefSeq Size | 3895 |
RefSeq ORF | 978 |
Synonyms | C20orf77; CREPT; dJ1057B20.2; K-H; Kub5-Hera; NET60 |
Locus ID | 58490 |
Cytogenetics | 20q11.23 |
Summary | Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. Transcriptional regulator which enhances expression of CCND1. Promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. Prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412017 | RPRD1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412017 | Transient overexpression lysate of regulation of nuclear pre-mRNA domain containing 1B (RPRD1B) |
CNY 3,080.00 |
|
TP307481 | Recombinant protein of human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B), 20 µg |
CNY 2,900.00 |
其它C20orf77产品