Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Mass Spec Standard
CAT#: PH307428
GPX7 MS Standard C13 and N15-labeled recombinant protein (NP_056511)
View other "Glutathione Peroxidase 7" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GPX7 MS Standard C13 and N15-labeled recombinant protein (NP_056511) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207428 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC207428 protein sequence
Red=Cloning site Green=Tags(s) MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056511 |
RefSeq Size | 1246 |
RefSeq ORF | 561 |
Synonyms | CL683; GPx-7; GPX6; GSHPx-7; NPGPx |
Locus ID | 2882 |
Cytogenetics | 1p32.3 |
Summary | It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Arachidonic acid metabolism, Glutathione metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414390 | GPX7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414390 | Transient overexpression lysate of glutathione peroxidase 7 (GPX7) |
CNY 3,080.00 |
|
TP307428 | Recombinant protein of human glutathione peroxidase 7 (GPX7), 20 µg |
CNY 2,900.00 |
|
TP701060 | Purified recombinant protein of Human glutathione peroxidase 7 (GPX7), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |
其它Glutathione Peroxidase 7产品