SOHLH1 (NM_001012415) Human Mass Spec Standard
CAT#: PH307282
SOHLH1 MS Standard C13 and N15-labeled recombinant protein (NP_001012415)
View other "SOHLH1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SOHLH1 MS Standard C13 and N15-labeled recombinant protein (NP_001012415) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207282 |
Predicted MW | 34.5 kDa |
Protein Sequence |
>RC207282 protein sequence
Red=Cloning site Green=Tags(s) MASRCSEPYPEVSRIPTVRGCNGSLSGALSCCEDSAQGSGPPKAPTVAEGPSSCLRRNVISERERRKRMS LSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASSKEMWHSLQEDVLQLTLSSQI QAGVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLC QVRGGLPPFSEPSSLVPWPPGRSLPKAVRPPLSWPPFSQQQTLPVMSGEALGWLGQAGSLAMGAAPLGEP AKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPGFRAGPPA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001012415 |
RefSeq Size | 1997 |
RefSeq ORF | 984 |
Synonyms | bA100C15.3; bHLHe80; C9orf157; NOHLH; ODG5; SPATA27; SPGF32; TEB2 |
Locus ID | 402381 |
Cytogenetics | 9q34.3 |
Summary | This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 9. Mutations in this gene are associated with nonobstructive azoospermia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420328 | SOHLH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422853 | SOHLH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420328 | Transient overexpression lysate of spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 1 |
CNY 3,080.00 |
|
LY422853 | Transient overexpression lysate of spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 2 |
CNY 3,080.00 |
|
TP307282 | Recombinant protein of human spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 2, 20 µg |
CNY 2,900.00 |