RAB28 (NM_001017979) Human Mass Spec Standard
CAT#: PH307206
RAB28 MS Standard C13 and N15-labeled recombinant protein (NP_001017979)
View other "RAB28" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB28 MS Standard C13 and N15-labeled recombinant protein (NP_001017979) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207206 |
Predicted MW | 24.8 kDa |
Protein Sequence |
>RC207206 protein sequence
Red=Cloning site Green=Tags(s) MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIG GQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIK PEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTV NPPRSSMCAVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001017979 |
RefSeq Size | 1732 |
RefSeq ORF | 663 |
Synonyms | CORD18 |
Locus ID | 9364 |
Cytogenetics | 4p15.33 |
Summary | This gene encodes a member of the Rab subfamily of Ras-related small GTPases. The encoded protein may be involved in regulating intracellular trafficking. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 9 and X. [provided by RefSeq, Apr 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422223 | RAB28 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431163 | RAB28 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422223 | Transient overexpression lysate of RAB28, member RAS oncogene family (RAB28), transcript variant 1 |
CNY 3,080.00 |
|
LY431163 | Transient overexpression lysate of RAB28, member RAS oncogene family (RAB28), transcript variant 3 |
CNY 3,080.00 |
|
TP307206 | Recombinant protein of human RAB28, member RAS oncogene family (RAB28), transcript variant 1, 20 µg |
CNY 2,900.00 |