KCNRG (NM_173605) Human Mass Spec Standard
CAT#: PH307143
KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_775876)
View other "KCNRG" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_775876) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207143 |
Predicted MW | 31 kDa |
Protein Sequence |
>RC207143 protein sequence
Red=Cloning site Green=Tags(s) MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQL LLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRI TVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRYVSIKPDNRKLANGTNV LGLLIDTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPEQSQIKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_775876 |
RefSeq Size | 1527 |
RefSeq ORF | 816 |
Synonyms | DLTET |
Locus ID | 283518 |
Cytogenetics | 13q14.2 |
Summary | This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403557 | KCNRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404578 | KCNRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403557 | Transient overexpression lysate of potassium channel regulator (KCNRG), transcript variant 1 |
CNY 3,080.00 |
|
LY404578 | Transient overexpression lysate of potassium channel regulator (KCNRG), transcript variant 2 |
CNY 3,080.00 |
|
PH312086 | KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_955751) |
CNY 19,520.00 |
|
TP307143 | Recombinant protein of human potassium channel regulator (KCNRG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312086 | Recombinant protein of human potassium channel regulator (KCNRG), transcript variant 2, 20 µg |
CNY 2,900.00 |