C7orf16 (PPP1R17) (NM_006658) Human Mass Spec Standard
CAT#: PH307007
C7orf16 MS Standard C13 and N15-labeled recombinant protein (NP_006649)
View other "C7orf16" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | C7orf16 MS Standard C13 and N15-labeled recombinant protein (NP_006649) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207007 |
Predicted MW | 17.9 kDa |
Protein Sequence |
>RC207007 protein sequence
Red=Cloning site Green=Tags(s) MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPA LHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPK AIVEDDEKDGDKIAI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006649 |
RefSeq Size | 1966 |
RefSeq ORF | 465 |
Synonyms | C7orf16; GSBS |
Locus ID | 10842 |
Cytogenetics | 7p14.3 |
Summary | The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Pathways | Long-term depression |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416501 | PPP1R17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416501 | Transient overexpression lysate of chromosome 7 open reading frame 16 (C7orf16), transcript variant 1 |
CNY 3,080.00 |
|
TP307007 | Recombinant protein of human chromosome 7 open reading frame 16 (C7orf16), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它C7orf16产品