RNF36 (TRIM69) (NM_080745) Human Mass Spec Standard
CAT#: PH306702
TRIM69 MS Standard C13 and N15-labeled recombinant protein (NP_542783)
View other "RNF36" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TRIM69 MS Standard C13 and N15-labeled recombinant protein (NP_542783) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206702 |
Predicted MW | 39.3 kDa |
Protein Sequence |
>RC206702 protein sequence
Red=Cloning site Green=Tags(s) MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEG KALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNL GQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGDIKKIMPDDPERFDSSVAVLG SRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRNQTDLKALDLPSFSLTLTNN LDKVGIYLDYEGGQLSFYNAKTMTHIYTFSNTFMEKLYPYFCPCLNDGGENKEPLHILHPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_542783 |
RefSeq Size | 1437 |
RefSeq ORF | 1023 |
Synonyms | HSD-34; HSD34; RNF36; Trif |
Locus ID | 140691 |
Cytogenetics | 15q21.1 |
Summary | This gene encodes a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405299 | TRIM69 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409062 | TRIM69 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405299 | Transient overexpression lysate of tripartite motif-containing 69 (TRIM69), transcript variant a |
CNY 3,080.00 |
|
LY409062 | Transient overexpression lysate of tripartite motif-containing 69 (TRIM69), transcript variant b |
CNY 3,080.00 |
|
TP306702 | Recombinant protein of human tripartite motif-containing 69 (TRIM69), transcript variant b, 20 µg |
CNY 2,900.00 |