MDC (CCL22) (NM_002990) Human Mass Spec Standard

Specifications

Product Data
Description	CCL22 MS Standard C13 and N15-labeled recombinant protein (NP_002981)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC206578
Predicted MW	10.6 kDa
Protein Sequence	Sequence Link (showhide) >RC206578 protein sequence Red=Cloning site Green=Tags(s) MARLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF RDKEICADPRVPWVKMILNKLSQ myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_002981
RefSeq Size	2933
RefSeq ORF	279
Synonyms	A-152E5.1; ABCD-1; DC/B-CK; MDC; SCYA22; STCP-1
Locus ID	6367
Cytogenetics	16q21
Summary	This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014]
Protein Families	Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways	Chemokine signaling pathway, Cytokine-cytokine receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.