WFDC1 (NM_021197) Human Mass Spec Standard
CAT#: PH306450
WFDC1 MS Standard C13 and N15-labeled recombinant protein (NP_067020)
View other "WFDC1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | WFDC1 MS Standard C13 and N15-labeled recombinant protein (NP_067020) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206450 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC206450 representing NM_021197
Red=Cloning site Green=Tags(s) MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPP RTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQ AEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAE PGRGQQKHFQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_067020 |
RefSeq Size | 1396 |
RefSeq ORF | 660 |
Synonyms | PS20 |
Locus ID | 58189 |
Cytogenetics | 16q24.1 |
Summary | This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. This gene is downregulated in many cancer types and may be involved in the inhibition of cell proliferation. The encoded protein may also play a role in the susceptibility of certain CD4 memory T cells to human immunodeficiency virus infection. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412036 | WFDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412036 | Transient overexpression lysate of WAP four-disulfide core domain 1 (WFDC1) |
CNY 3,080.00 |
|
TP306450 | Purified recombinant protein of Homo sapiens WAP four-disulfide core domain 1 (WFDC1), 20 µg |
CNY 2,900.00 |