MTP18 (MTFP1) (NM_016498) Human Mass Spec Standard
CAT#: PH305922
MTP18 MS Standard C13 and N15-labeled recombinant protein (NP_057582)
View other "MTP18" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | MTP18 MS Standard C13 and N15-labeled recombinant protein (NP_057582) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205922 |
Predicted MW | 18 kDa |
Protein Sequence |
>RC205922 protein sequence
Red=Cloning site Green=Tags(s) MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPE AGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHP IDRSVDFLLDSSLRKLYPTVGKPSSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057582 |
RefSeq Size | 1298 |
RefSeq ORF | 498 |
Synonyms | HSPC242; MTP18 |
Locus ID | 51537 |
Cytogenetics | 22q12.2 |
Summary | MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423990 | MTFP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423990 | Transient overexpression lysate of mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
TP305922 | Purified recombinant protein of Homo sapiens mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |