Asialoglycoprotein Receptor 1 (ASGR1) (NM_001671) Human Mass Spec Standard
CAT#: PH305686
ASGR1 MS Standard C13 and N15-labeled recombinant protein (NP_001662)
View other "Asialoglycoprotein Receptor 1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ASGR1 MS Standard C13 and N15-labeled recombinant protein (NP_001662) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205686 |
Predicted MW | 33.2 kDa |
Protein Sequence |
>RC205686 protein sequence
Red=Cloning site Green=Tags(s) MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEEL RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQ MAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNT WMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETE LDKASQEPPLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001662 |
RefSeq Size | 1519 |
RefSeq ORF | 873 |
Synonyms | ASGPR; ASGPR1; CLEC4H1; HL-1 |
Locus ID | 432 |
Cytogenetics | 17p13.1 |
Summary | This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the more abundant major subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400631 | ASGR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434100 | ASGR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400631 | Transient overexpression lysate of asialoglycoprotein receptor 1 (ASGR1) |
CNY 3,080.00 |
|
LY434100 | Transient overexpression lysate of asialoglycoprotein receptor 1 (ASGR1), transcript variant 2 |
CNY 3,080.00 |
|
TP305686 | Recombinant protein of human asialoglycoprotein receptor 1 (ASGR1), 20 µg |
CNY 2,900.00 |
|
TP710055 | Recombinant protein of human desmin(DES),full length,with C-terminal flag tag, expressed in sf9 cells |
CNY 4,020.00 |
其它Asialoglycoprotein Receptor 1产品