SAP18 (NM_005870) Human Mass Spec Standard
CAT#: PH305607
SAP18 MS Standard C13 and N15-labeled recombinant protein (NP_005861)
View other "SAP18" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SAP18 MS Standard C13 and N15-labeled recombinant protein (NP_005861) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205607 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC205607 protein sequence
Red=Cloning site Green=Tags(s) MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELT SLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP NRAPPTSGRMRPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005861 |
RefSeq Size | 2318 |
RefSeq ORF | 459 |
Synonyms | 2HOR0202; SAP18P |
Locus ID | 10284 |
Cytogenetics | 13q12.11 |
Summary | Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417012 | SAP18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417012 | Transient overexpression lysate of Sin3A-associated protein, 18kDa (SAP18) |
CNY 3,080.00 |
|
TP305607 | Recombinant protein of human Sin3A-associated protein, 18kDa (SAP18), 20 µg |
CNY 2,900.00 |