SCAMP1 (NM_004866) Human Mass Spec Standard
CAT#: PH305499
SCAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_004857)
View other "SCAMP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SCAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_004857) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205499 |
Predicted MW | 37.9 kDa |
Protein Sequence |
>RC205499 protein sequence
Red=Cloning site Green=Tags(s) MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEH PAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVD IPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAF RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLV MFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004857 |
RefSeq Size | 6275 |
RefSeq ORF | 1014 |
Synonyms | SCAMP; SCAMP37 |
Locus ID | 9522 |
Cytogenetics | 5q14.1 |
Summary | This gene product belongs to the SCAMP family of proteins, which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that these protein family members may function at the same site during vesicular transport rather than in separate pathways. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417666 | SCAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417666 | Transient overexpression lysate of secretory carrier membrane protein 1 (SCAMP1) |
CNY 3,080.00 |
|
TP305499 | Recombinant protein of human secretory carrier membrane protein 1 (SCAMP1), 20 µg |
CNY 2,900.00 |