MAGEB2 (NM_002364) Human Mass Spec Standard
CAT#: PH305338
MAGEB2 MS Standard C13 and N15-labeled recombinant protein (NP_002355)
View other "MAGEB2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MAGEB2 MS Standard C13 and N15-labeled recombinant protein (NP_002355) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205338 |
Predicted MW | 35.3 kDa |
Protein Sequence |
>RC205338 protein sequence
Red=Cloning site Green=Tags(s) MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAA AAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKI VGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGV IFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAY AETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002355 |
RefSeq Size | 1628 |
RefSeq ORF | 957 |
Synonyms | CT3.2; DAM6; MAGE-XP-2 |
Locus ID | 4113 |
Cytogenetics | Xp21.2 |
Summary | This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region. It is expressed in testis and placenta, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419377 | MAGEB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419377 | Transient overexpression lysate of melanoma antigen family B, 2 (MAGEB2) |
CNY 3,080.00 |
|
TP305338 | Recombinant protein of human melanoma antigen family B, 2 (MAGEB2), 20 µg |
CNY 2,900.00 |