SERPINB8 (NM_001031848) Human Mass Spec Standard
CAT#: PH305135
SERPINB8 MS Standard C13 and N15-labeled recombinant protein (NP_001027018)
View other "SERPINB8" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | SERPINB8 MS Standard C13 and N15-labeled recombinant protein (NP_001027018) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205135 |
Predicted MW | 27.7 kDa |
Protein Sequence |
>RC205135 protein sequence
Red=Cloning site Green=Tags(s) MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGF QSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKT EGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE VHTQVLELPYVEEELSMVILLPDDNTDLAVKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001027018 |
RefSeq Size | 1409 |
RefSeq ORF | 726 |
Synonyms | C18orf53; CAP2; PI-8; PI8; PSS5 |
Locus ID | 5271 |
Cytogenetics | 18q22.1 |
Summary | The protein encoded by this gene is a member of the ov-serpin family of serine protease inhibitors. The encoded protein is produced by platelets and can bind to and inhibit the function of furin, a serine protease involved in platelet functions. In addition, this protein has been found to enhance the mechanical stability of cell-cell adhesion in the skin, and defects in this gene have been associated with an autosomal-recessive form of exfoliative ichthyosis. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404778 | SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419193 | SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422205 | SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404778 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 2 |
CNY 3,080.00 |
|
LY419193 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 1 |
CNY 3,080.00 |
|
LY422205 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3 |
CNY 3,080.00 |
|
PH323880 | SERPINB8 MS Standard C13 and N15-labeled recombinant protein (NP_002631) |
CNY 14,250.00 |
|
TP305135 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP323880 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它SERPINB8产品