RAB2B (NM_032846) Human Mass Spec Standard
CAT#: PH305033
RAB2B MS Standard C13 and N15-labeled recombinant protein (NP_116235)
View other "RAB2B" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB2B MS Standard C13 and N15-labeled recombinant protein (NP_116235) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205033 |
Predicted MW | 24.2 kDa |
Protein Sequence |
>RC205033 protein sequence
Red=Cloning site Green=Tags(s) MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFARE HGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIG SNSGCC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116235 |
RefSeq Size | 2956 |
RefSeq ORF | 648 |
Locus ID | 84932 |
Cytogenetics | 14q11.2 |
Summary | Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508.[supplied by OMIM, Apr 2006] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409882 | RAB2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431135 | RAB2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409882 | Transient overexpression lysate of RAB2B, member RAS oncogene family (RAB2B), transcript variant 1 |
CNY 3,080.00 |
|
LY431135 | Transient overexpression lysate of RAB2B, member RAS oncogene family (RAB2B), transcript variant 2 |
CNY 3,080.00 |
|
TP305033 | Recombinant protein of human RAB2B, member RAS oncogene family (RAB2B), 20 µg |
CNY 2,900.00 |