CDC42EP2 (NM_006779) Human Mass Spec Standard
CAT#: PH304974
CDC42EP2 MS Standard C13 and N15-labeled recombinant protein (NP_006770)
View other "CDC42EP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CDC42EP2 MS Standard C13 and N15-labeled recombinant protein (NP_006770) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204974 |
Predicted MW | 22.5 kDa |
Protein Sequence |
>RC204974 protein sequence
Red=Cloning site Green=Tags(s) MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMV EGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQP SPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006770 |
RefSeq Size | 2043 |
RefSeq ORF | 630 |
Synonyms | BORG1; CEP2 |
Locus ID | 10435 |
Cytogenetics | 11q13.1 |
Summary | CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of CDC42. Coexpression of this protein with CDC42 suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416424 | CDC42EP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416424 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2) |
CNY 3,080.00 |
|
TP304974 | Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2), 20 µg |
CNY 2,900.00 |
其它CDC42EP2产品