RPB11 (POLR2J) (NM_006234) Human Mass Spec Standard
CAT#: PH304819
POLR2J MS Standard C13 and N15-labeled recombinant protein (NP_006225)
View other "RPB11" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | POLR2J MS Standard C13 and N15-labeled recombinant protein (NP_006225) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204819 |
Predicted MW | 13.3 kDa |
Protein Sequence |
>RC204819 protein sequence
Red=Cloning site Green=Tags(s) MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHK IIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006225 |
RefSeq Size | 991 |
RefSeq ORF | 351 |
Synonyms | hRPB14; POLR2J1; RPB11; RPB11A; RPB11m |
Locus ID | 5439 |
Cytogenetics | 7q22.1 |
Summary | This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401876 | POLR2J HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401876 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa (POLR2J) |
CNY 3,080.00 |
|
TP304819 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa (POLR2J), 20 µg |
CNY 2,900.00 |