HSPC014 (POMP) (NM_015932) Human Mass Spec Standard
CAT#: PH304812
POMP MS Standard C13 and N15-labeled recombinant protein (NP_057016)
View other "HSPC014" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | POMP MS Standard C13 and N15-labeled recombinant protein (NP_057016) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204812 |
Predicted MW | 15.8 kDa |
Protein Sequence |
>RC204812 protein sequence
Red=Cloning site Green=Tags(s) MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL L myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057016 |
RefSeq Size | 1477 |
RefSeq ORF | 423 |
Synonyms | C13orf12; HSPC014; PNAS-110; PRAAS2; UMP1 |
Locus ID | 51371 |
Cytogenetics | 13q12.3 |
Summary | The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.[provided by RefSeq, Aug 2010] |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402471 | POMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402471 | Transient overexpression lysate of proteasome maturation protein (POMP) |
CNY 3,080.00 |
|
TP304812 | Recombinant protein of human proteasome maturation protein (POMP), 20 µg |
CNY 2,900.00 |
其它HSPC014产品