GJB3 (NM_001005752) Human Mass Spec Standard
CAT#: PH304405
GJB3 MS Standard C13 and N15-labeled recombinant protein (NP_001005752)
View other "GJB3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | GJB3 MS Standard C13 and N15-labeled recombinant protein (NP_001005752) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204405 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC204405 protein sequence
Red=Cloning site Green=Tags(s) MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGCTNVCYDNYFP ISNIRLWALQLIFVTCPSLLVILHVAYREERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLI IEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLI CHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGEVDPDPGNNKLQASAPNLTPI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001005752 |
RefSeq Size | 1777 |
RefSeq ORF | 810 |
Synonyms | CX31; DFNA2; DFNA2B; EKV; EKVP1 |
Locus ID | 2707 |
Cytogenetics | 1p34.3 |
Summary | This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene can cause non-syndromic deafness or erythrokeratodermia variabilis, a skin disorder. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402970 | GJB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423651 | GJB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402970 | Transient overexpression lysate of gap junction protein, beta 3, 31kDa (GJB3), transcript variant 1 |
CNY 3,080.00 |
|
LY423651 | Transient overexpression lysate of gap junction protein, beta 3, 31kDa (GJB3), transcript variant 2 |
CNY 3,080.00 |
|
TP304405 | Recombinant protein of human gap junction protein, beta 3, 31kDa (GJB3), transcript variant 2, 20 µg |
CNY 2,900.00 |