NIP30 (FAM192A) (NM_024946) Human Mass Spec Standard
CAT#: PH304378
FAM192A MS Standard C13 and N15-labeled recombinant protein (NP_079222)
View other "NIP30" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FAM192A MS Standard C13 and N15-labeled recombinant protein (NP_079222) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204378 |
Predicted MW | 28.9 kDa |
Protein Sequence |
>RC204378 protein sequence
Red=Cloning site Green=Tags(s) MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYE EQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKP IETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIG ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079222 |
RefSeq Size | 2865 |
RefSeq ORF | 762 |
Synonyms | C16orf94; CDA018; CDA10; FAM192A; NIP30; PIP30 |
Locus ID | 80011 |
Cytogenetics | 16q13 |
Summary | Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the catalytic chamber of the proteasome. Also inhibits the interaction of PSME3 with COIL, inhibits accumulation of PSME3 in Cajal bodies and positively regulates the number of Cajal bodies in the nucleus.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403039 | FAM192A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403039 | Transient overexpression lysate of family with sequence similarity 192, member A (FAM192A) |
CNY 3,080.00 |
|
TP304378 | Recombinant protein of human NEFA-interacting nuclear protein NIP30 (NIP30), 20 µg |
CNY 2,900.00 |