DAZAP1 (NM_018959) Human Mass Spec Standard
CAT#: PH304091
DAZAP1 MS Standard C13 and N15-labeled recombinant protein (NP_061832)
View other "DAZAP1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DAZAP1 MS Standard C13 and N15-labeled recombinant protein (NP_061832) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204091 |
Predicted MW | 43.4 kDa |
Protein Sequence |
>RC204091 protein sequence
Red=Cloning site Green=Tags(s) MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS RPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVT EVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRV VPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGF PQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYA GYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061832 |
RefSeq Size | 2215 |
RefSeq ORF | 1221 |
Locus ID | 26528 |
Cytogenetics | 19p13.3 |
Summary | In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406890 | DAZAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412847 | DAZAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406890 | Transient overexpression lysate of DAZ associated protein 1 (DAZAP1), transcript variant 1 |
CNY 3,080.00 |
|
LY412847 | Transient overexpression lysate of DAZ associated protein 1 (DAZAP1), transcript variant 2 |
CNY 3,080.00 |
|
TP304091 | Recombinant protein of human DAZ associated protein 1 (DAZAP1), transcript variant 2, 20 µg |
CNY 2,900.00 |