RCL (DNPH1) (NM_006443) Human Mass Spec Standard
CAT#: PH303989
C6orf108 MS Standard C13 and N15-labeled recombinant protein (NP_006434)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | C6orf108 MS Standard C13 and N15-labeled recombinant protein (NP_006434) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203989 |
Predicted MW | 19.1 kDa |
Protein Sequence |
>RC203989 protein sequence
Red=Cloning site Green=Tags(s) MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAA GGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRF QVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006434 |
RefSeq Size | 662 |
RefSeq ORF | 522 |
Synonyms | C6orf108; dJ330M21.3; RCL |
Locus ID | 10591 |
Cytogenetics | 6p21.1 |
Summary | This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404680 | DNPH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416630 | DNPH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404680 | Transient overexpression lysate of chromosome 6 open reading frame 108 (C6orf108), transcript variant 2 |
CNY 3,080.00 |
|
LY416630 | Transient overexpression lysate of chromosome 6 open reading frame 108 (C6orf108), transcript variant 1 |
CNY 3,080.00 |
|
TP303989 | Recombinant protein of human chromosome 6 open reading frame 108 (C6orf108), transcript variant 1, 20 µg |
CNY 2,900.00 |