BRMS1 (NM_015399) Human Mass Spec Standard
CAT#: PH303428
BRMS1 MS Standard C13 and N15-labeled recombinant protein (NP_056214)
View other "BRMS1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BRMS1 MS Standard C13 and N15-labeled recombinant protein (NP_056214) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203428 |
Predicted MW | 28.5 kDa |
Protein Sequence |
>RC203428 protein sequence
Red=Cloning site Green=Tags(s) MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG PYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056214 |
RefSeq Size | 1455 |
RefSeq ORF | 738 |
Locus ID | 25855 |
Cytogenetics | 11q13.2 |
Summary | This gene reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase complexes (HDAC). The protein contains two coiled-coil motifs and several imperfect leucine zipper motifs. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414569 | BRMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422568 | BRMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425471 | BRMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414569 | Transient overexpression lysate of breast cancer metastasis suppressor 1 (BRMS1), transcript variant 1 |
CNY 3,080.00 |
|
LY422568 | Transient overexpression lysate of breast cancer metastasis suppressor 1 (BRMS1), transcript variant 2 |
CNY 3,080.00 |
|
TP303428 | Recombinant protein of human breast cancer metastasis suppressor 1 (BRMS1), transcript variant 1, 20 µg |
CNY 2,900.00 |