CAB39L (NM_030925) Human Mass Spec Standard
CAT#: PH303394
CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187)
View other "CAB39L" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203394 |
Predicted MW | 39.2 kDa |
Protein Sequence |
>RC203394 protein sequence
Red=Cloning site Green=Tags(s) MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112187 |
RefSeq Size | 3631 |
RefSeq ORF | 1011 |
Synonyms | bA103J18.3; MO2L; MO25-BETA |
Locus ID | 81617 |
Cytogenetics | 13q14.2 |
Summary | Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | mTOR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410660 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421532 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410660 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1 |
CNY 3,080.00 |
|
LY421532 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 |
CNY 3,080.00 |
|
PH311881 | CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_001073138) |
CNY 19,520.00 |
|
TP303394 | Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311881 | Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2, 20 µg |
CNY 2,900.00 |