ATP6J (ATP6V1G1) (NM_004888) Human Mass Spec Standard

Specifications

Product Data
Description	ATP6V1G1 MS Standard C13 and N15-labeled recombinant protein (NP_004879)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC203317
Predicted MW	13.8 kDa
Protein Sequence	Sequence Link (showhide) >RC203317 protein sequence Red=Cloning site Green=Tags(s) MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_004879
RefSeq Size	1611
RefSeq ORF	354
Synonyms	ATP6G; ATP6G1; ATP6GL; ATP6J; Vma10
Locus ID	9550
Cytogenetics	9q32
Summary	This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of three V1 domain G subunit proteins. Pseudogenes of this gene have been characterized. [provided by RefSeq, Jul 2008]
Protein Pathways	Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.