MT1H (NM_005951) Human Mass Spec Standard
CAT#: PH303257
MT1H MS Standard C13 and N15-labeled recombinant protein (NP_005942)
View other "MT1H" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MT1H MS Standard C13 and N15-labeled recombinant protein (NP_005942) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203257 |
Predicted MW | 6 kDa |
Protein Sequence |
>RC203257 protein sequence
Red=Cloning site Green=Tags(s) MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCCA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005942 |
RefSeq Size | 397 |
RefSeq ORF | 183 |
Synonyms | MT-0; MT-1H; MT-IH; MT1 |
Locus ID | 4496 |
Cytogenetics | 16q13 |
Summary | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401801 | MT1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401801 | Transient overexpression lysate of metallothionein 1H (MT1H) |
CNY 3,080.00 |
|
TP303257 | Recombinant protein of human metallothionein 1H (MT1H), 20 µg |
CNY 2,900.00 |