Density Regulated Protein (DENR) (NM_003677) Human Mass Spec Standard
CAT#: PH303227
DENR MS Standard C13 and N15-labeled recombinant protein (NP_003668)
View other "Density Regulated Protein" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Cited in 2 publications. |
Specifications
Product Data | |
Description | DENR MS Standard C13 and N15-labeled recombinant protein (NP_003668) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203227 |
Predicted MW | 22.1 kDa |
Protein Sequence |
>RC203227 protein sequence
Red=Cloning site Green=Tags(s) MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTV ENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEID LKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003668 |
RefSeq Size | 3061 |
RefSeq ORF | 594 |
Synonyms | DRP; DRP1; SMAP-3 |
Locus ID | 8562 |
Cytogenetics | 12q24.31 |
Summary | This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Hkat, a novel nutritionally regulated transmembrane protein in adipose tissues
,null,
Scientific Reports
,PubMed ID 23152936
[DENR]
|
Nrac, a Novel Nutritionally-Regulated Adipose and Cardiac-Enriched Gene
,null,
PLoS ONE
,PubMed ID 23029450
[DENR]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418507 | DENR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418507 | Transient overexpression lysate of density-regulated protein (DENR) |
CNY 3,080.00 |
|
TP303227 | Recombinant protein of human density-regulated protein (DENR), 20 µg |
CNY 2,900.00 |
其它Density Regulated Protein产品