ISG20 (NM_002201) Human Mass Spec Standard
CAT#: PH303178
ISG20 MS Standard C13 and N15-labeled recombinant protein (NP_002192)
View other "ISG20" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ISG20 MS Standard C13 and N15-labeled recombinant protein (NP_002192) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203178 |
Predicted MW | 20.4 kDa |
Protein Sequence |
>RC203178 protein sequence
Red=Cloning site Green=Tags(s) MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002192 |
RefSeq Size | 974 |
RefSeq ORF | 543 |
Synonyms | CD25; HEM45 |
Locus ID | 3669 |
Cytogenetics | 15q26.1 |
Summary | Interferon-induced antiviral exoribonuclease that acts on single-stranded RNA and also has minor activity towards single-stranded DNA. Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV) and yellow fever virus (YFV) in an exonuclease-dependent manner. May also play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419473 | ISG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419473 | Transient overexpression lysate of interferon stimulated exonuclease gene 20kDa (ISG20) |
CNY 3,080.00 |
|
TP303178 | Recombinant protein of human interferon stimulated exonuclease gene 20kDa (ISG20), 20 µg |
CNY 2,900.00 |