NAT8 (NM_003960) Human Mass Spec Standard
CAT#: PH303157
NAT8 MS Standard C13 and N15-labeled recombinant protein (NP_003951)
View other "NAT8" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NAT8 MS Standard C13 and N15-labeled recombinant protein (NP_003951) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203157 |
Predicted MW | 25.6 kDa |
Protein Sequence |
>RC203157 protein sequence
Red=Cloning site Green=Tags(s) MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISL FPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLF HLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVAL HTVHFIYHLPSSKVGSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003951 |
RefSeq Size | 1073 |
RefSeq ORF | 681 |
Synonyms | ATase2; CCNAT; CML1; GLA; Hcml1; TSC501; TSC510 |
Locus ID | 9027 |
Cytogenetics | 2p13.1 |
Summary | This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene. [provided by RefSeq, Sep 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401303 | NAT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401303 | Transient overexpression lysate of N-acetyltransferase 8 (GCN5-related, putative) (NAT8) |
CNY 3,080.00 |
|
TP303157 | Recombinant protein of human N-acetyltransferase 8 (GCN5-related, putative) (NAT8), 20 µg |
CNY 2,900.00 |