trfp (MED20) (NM_004275) Human Mass Spec Standard
CAT#: PH303152
MED20 MS Standard C13 and N15-labeled recombinant protein (NP_004266)
View other "trfp" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MED20 MS Standard C13 and N15-labeled recombinant protein (NP_004266) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203152 |
Predicted MW | 23.2 kDa |
Protein Sequence |
>RC203152 protein sequence
Red=Cloning site Green=Tags(s) MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSE YPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISV EVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAG IR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004266 |
RefSeq Size | 2478 |
RefSeq ORF | 636 |
Synonyms | PRO0213; SRB2; TRFP |
Locus ID | 9477 |
Cytogenetics | 6p21.1 |
Summary | This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. A mutation in this gene has been associated with a novel infantile-onset neurodegenerative movement disorder. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Mar 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401368 | MED20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401368 | Transient overexpression lysate of mediator complex subunit 20 (MED20) |
CNY 3,080.00 |
|
TP303152 | Recombinant protein of human mediator complex subunit 20 (MED20), 20 µg |
CNY 2,900.00 |