MOSPD3 (NM_023948) Human Mass Spec Standard
CAT#: PH302908
MOSPD3 MS Standard C13 and N15-labeled recombinant protein (NP_076438)
View other "MOSPD3" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MOSPD3 MS Standard C13 and N15-labeled recombinant protein (NP_076438) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202908 |
Predicted MW | 25.5 kDa |
Protein Sequence |
>RC202908 protein sequence
Red=Cloning site Green=Tags(s) MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVL CTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAY PLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQV LHVSLGQKLVAAYVLGLLTMVFLRT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_076438 |
RefSeq Size | 1213 |
RefSeq ORF | 705 |
Synonyms | CDS3; NET30 |
Locus ID | 64598 |
Cytogenetics | 7q22.1 |
Summary | This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411401 | MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421670 | MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421671 | MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411401 | Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 1 |
CNY 3,080.00 |
|
LY421670 | Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 2 |
CNY 3,080.00 |
|
LY421671 | Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 3 |
CNY 3,080.00 |
|
TP302908 | Recombinant protein of human motile sperm domain containing 3 (MOSPD3), transcript variant 1, 20 µg |
CNY 2,900.00 |