PHAP1 (ANP32A) (NM_006305) Human Mass Spec Standard
CAT#: PH302868
ANP32A MS Standard C13 and N15-labeled recombinant protein (NP_006296)
View other "PHAP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ANP32A MS Standard C13 and N15-labeled recombinant protein (NP_006296) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202868 |
Predicted MW | 28.6 kDa |
Protein Sequence |
>RC202868 protein sequence
Red=Cloning site Green=Tags(s) MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006296 |
RefSeq Size | 2479 |
RefSeq ORF | 747 |
Synonyms | C15orf1; HPPCn; I1PP2A; LANP; MAPM; PHAP1; PHAPI; PP32 |
Locus ID | 8125 |
Cytogenetics | 15q23 |
Summary | Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416747 | ANP32A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416747 | Transient overexpression lysate of acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A) |
CNY 3,080.00 |
|
TP302868 | Recombinant protein of human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A), 20 µg |
CNY 2,900.00 |