Geminin (GMNN) (NM_015895) Human Mass Spec Standard
CAT#: PH302808
GMNN MS Standard C13 and N15-labeled recombinant protein (NP_056979)
View other "Geminin" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GMNN MS Standard C13 and N15-labeled recombinant protein (NP_056979) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202808 |
Predicted MW | 23.6 kDa |
Protein Sequence |
>RC202808 protein sequence
Red=Cloning site Green=Tags(s) MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVP ESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKE LAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056979 |
RefSeq Size | 1275 |
RefSeq ORF | 627 |
Synonyms | Gem; MGORS6 |
Locus ID | 51053 |
Cytogenetics | 6p22.3 |
Summary | This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-replication complex. The encoded protein is expressed during the S and G2 phases of the cell cycle and is degraded by the anaphase-promoting complex during the metaphase-anaphase transition. Increased expression of this gene may play a role in several malignancies including colon, rectal and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and two pseudogenes of this gene are located on the short arm of chromosome 16. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402469 | GMNN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402469 | Transient overexpression lysate of geminin, DNA replication inhibitor (GMNN) |
CNY 3,080.00 |
|
TP302808 | Recombinant protein of human geminin, DNA replication inhibitor (GMNN), 20 µg |
CNY 2,900.00 |
其它Geminin产品