Centrin 3 (CETN3) (NM_004365) Human Mass Spec Standard
CAT#: PH302804
CETN3 MS Standard C13 and N15-labeled recombinant protein (NP_004356)
View other "Centrin 3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CETN3 MS Standard C13 and N15-labeled recombinant protein (NP_004356) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202804 |
Predicted MW | 19.6 kDa |
Protein Sequence |
>RC202804 protein sequence
Red=Cloning site Green=Tags(s) MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKIL KDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR AMIEEFDKDGDGEINQEEFIAIMTGDI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004356 |
RefSeq Size | 1374 |
RefSeq ORF | 501 |
Synonyms | CDC31; CEN3 |
Locus ID | 1070 |
Cytogenetics | 5q14.3 |
Summary | The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418039 | CETN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418039 | Transient overexpression lysate of centrin, EF-hand protein, 3 (CDC31 homolog, yeast) (CETN3) |
CNY 3,080.00 |
|
TP302804 | Recombinant protein of human centrin, EF-hand protein, 3 (CDC31 homolog, yeast) (CETN3), 20 µg |
CNY 2,900.00 |
其它Centrin 3产品