RGS2 (NM_002923) Human Mass Spec Standard
CAT#: PH302781
RGS2 MS Standard C13 and N15-labeled recombinant protein (NP_002914)
View other "RGS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RGS2 MS Standard C13 and N15-labeled recombinant protein (NP_002914) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202781 |
Predicted MW | 24.4 kDa |
Protein Sequence |
>RC202781 protein sequence
Red=Cloning site Green=Tags(s) MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA T myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002914 |
RefSeq Size | 1375 |
RefSeq ORF | 633 |
Synonyms | G0S8 |
Locus ID | 5997 |
Cytogenetics | 1q31.2 |
Summary | Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 2 belongs to this family. The protein acts as a mediator of myeloid differentiation and may play a role in leukemogenesis. [provided by RefSeq, Aug 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401021 | RGS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401021 | Transient overexpression lysate of regulator of G-protein signaling 2, 24kDa (RGS2) |
CNY 3,080.00 |
|
TP302781 | Recombinant protein of human regulator of G-protein signaling 2, 24kDa (RGS2), 20 µg |
CNY 2,900.00 |