myosin light chain 1 (MYL1) (NM_079422) Human Mass Spec Standard
CAT#: PH302750
MYL1 MS Standard C13 and N15-labeled recombinant protein (NP_524146)
View other "myosin light chain 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MYL1 MS Standard C13 and N15-labeled recombinant protein (NP_524146) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202750 |
Predicted MW | 16.7 kDa |
Protein Sequence |
>RC202750 protein sequence
Red=Cloning site Green=Tags(s) MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL PMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINY EAFVKHIMSI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_524146 |
RefSeq Size | 862 |
RefSeq ORF | 450 |
Synonyms | MLC1F; MLC3F; MYOFTA |
Locus ID | 4632 |
Cytogenetics | 2q34 |
Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409202 | MYL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409202 | Transient overexpression lysate of myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f |
CNY 3,080.00 |
|
TP302750 | Recombinant protein of human myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, 20 µg |
CNY 2,900.00 |
其它myosin light chain 1产品