TIMM13 (NM_012458) Human Mass Spec Standard
CAT#: PH302268
TIMM13 MS Standard C13 and N15-labeled recombinant protein (NP_036590)
View other "TIMM13" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TIMM13 MS Standard C13 and N15-labeled recombinant protein (NP_036590) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202268 |
Predicted MW | 10.5 kDa |
Protein Sequence |
>RC202268 protein sequence
Red=Cloning site Green=Tags(s) MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCM DRYMDAWNTVSRAYNSRLQRERANM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036590 |
RefSeq Size | 2000 |
RefSeq ORF | 285 |
Synonyms | ppv1; TIM13; TIM13B; TIMM13A; TIMM13B |
Locus ID | 26517 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of this family play a role in collecting substrate proteins from the translocase of the outer mitochondrial membrane (TOM) complex and delivering them to either the sorting and assembly machinery in the outer mitochondrial membrane (SAM) complex or the TIMM22 complex in the inner mitochondrial membrane. The encoded protein and the translocase of mitochondrial inner membrane 8a protein form a 70 kDa complex in the intermembrane space. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415748 | TIMM13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415748 | Transient overexpression lysate of translocase of inner mitochondrial membrane 13 homolog (yeast) (TIMM13), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP302268 | Recombinant protein of human translocase of inner mitochondrial membrane 13 homolog (yeast) (TIMM13), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |