FKBP7 (NM_181342) Human Mass Spec Standard
CAT#: PH302176
FKBP7 MS Standard C13 and N15-labeled recombinant protein (NP_851939)
View other "FKBP7" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FKBP7 MS Standard C13 and N15-labeled recombinant protein (NP_851939) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202176 |
Predicted MW | 25.8 kDa |
Protein Sequence |
>RC202176 protein sequence
Red=Cloning site Green=Tags(s) MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSK FYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIE LYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFIS PKEYNVYQHDEL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_851939 |
RefSeq Size | 2904 |
RefSeq ORF | 666 |
Synonyms | FKBP23; PPIase |
Locus ID | 51661 |
Cytogenetics | 2q31.2 |
Summary | The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405796 | FKBP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427593 | FKBP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405796 | Transient overexpression lysate of FK506 binding protein 7 (FKBP7), transcript variant 1 |
CNY 3,080.00 |
|
LY427593 | Transient overexpression lysate of FK506 binding protein 7 (FKBP7), transcript variant 2 |
CNY 3,080.00 |
|
TP302176 | Recombinant protein of human FK506 binding protein 7 (FKBP7), transcript variant 1, 20 µg |
CNY 2,900.00 |