DNAJC12 (NM_021800) Human Mass Spec Standard
CAT#: PH301931
DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_068572)
View other "DNAJC12" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_068572) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201931 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC201931 protein sequence
Red=Cloning site Green=Tags(s) MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE SRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEEL ASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068572 |
RefSeq Size | 1218 |
RefSeq ORF | 594 |
Synonyms | HPANBH4; JDP1 |
Locus ID | 56521 |
Cytogenetics | 10q21.3 |
Summary | This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404589 | DNAJC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411920 | DNAJC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404589 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 2 |
CNY 3,080.00 |
|
LY411920 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1 |
CNY 3,080.00 |
|
PH315035 | DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_957714) |
CNY 14,250.00 |
|
TP301931 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP315035 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它DNAJC12产品